MSAD_210040.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210040.t1
Unique NameMSAD_210040.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length324
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210040MSAD_210040Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210040.t1MSAD_210040.t1-proteinMedicago sativapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210040.t1:exon:0MSAD_210040.t1:exon:0Medicago sativaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210040.t1:cdsMSAD_210040.t1:cdsMedicago sativaCDS


Synonyms
The feature 'MSAD_210040.t1' has the following synonyms
Synonym
augustus_masked-Scc4a34_14-processed-gene-0.0-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210040.t1 ID=MSAD_210040.t1|Name=MSAD_210040.t1|organism=Medicago sativa|type=mRNA|length=324bp
ATGGCCGGGTGGATCGACGTTCATGCACAATTCAACAGCGGAGAACCTCA
GCGGTTGAAGGTTCAGTGTCGTGGTGTAACGCTAAGAGGTCTCAAGGATC
AACTGGATGAATTCAACCAAGTAGTAAACCCCGGAGACACAAGGAAGGTG
GAATGTGTTTGCTATAAACGTCCAACGCTCGACGACGGGAGAATATCATT
CAGTTGGGTGGAATTAACGAACGACGAAAACGTGAAGAACATGTTTTGGG
AGCACATCATGTTCCAGTGGATCGATATGCGGGTAACGTTGTTGAGATCA
ACTGAAGATATATCAAGAGTCTGA
back to top

protein sequence of MSAD_210040.t1

>MSAD_210040.t1-protein ID=MSAD_210040.t1-protein|Name=MSAD_210040.t1|organism=Medicago sativa|type=polypeptide|length=108bp
MAGWIDVHAQFNSGEPQRLKVQCRGVTLRGLKDQLDEFNQVVNPGDTRKV
ECVCYKRPTLDDGRISFSWVELTNDENVKNMFWEHIMFQWIDMRVTLLRS
TEDISRV.
back to top

mRNA from alignment at Scc4a34_14:10960..11283+

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210040.t1 ID=MSAD_210040.t1|Name=MSAD_210040.t1|organism=Medicago sativa|type=mRNA|length=324bp|location=Sequence derived from alignment at Scc4a34_14:10960..11283+ (Medicago sativa)
ATGGCCGGGTGGATCGACGTTCATGCACAATTCAACAGCGGAGAACCTCA GCGGTTGAAGGTTCAGTGTCGTGGTGTAACGCTAAGAGGTCTCAAGGATC AACTGGATGAATTCAACCAAGTAGTAAACCCCGGAGACACAAGGAAGGTG GAATGTGTTTGCTATAAACGTCCAACGCTCGACGACGGGAGAATATCATT CAGTTGGGTGGAATTAACGAACGACGAAAACGTGAAGAACATGTTTTGGG AGCACATCATGTTCCAGTGGATCGATATGCGGGTAACGTTGTTGAGATCA ACTGAAGATATATCAAGAGTCTGA
back to top

Coding sequence (CDS) from alignment at Scc4a34_14:10960..11283+

>MSAD_210040.t1 ID=MSAD_210040.t1|Name=MSAD_210040.t1|organism=Medicago sativa|type=CDS|length=324bp|location=Sequence derived from alignment at Scc4a34_14:10960..11283+ (Medicago sativa)
ATGGCCGGGTGGATCGACGTTCATGCACAATTCAACAGCGGAGAACCTCA
GCGGTTGAAGGTTCAGTGTCGTGGTGTAACGCTAAGAGGTCTCAAGGATC
AACTGGATGAATTCAACCAAGTAGTAAACCCCGGAGACACAAGGAAGGTG
GAATGTGTTTGCTATAAACGTCCAACGCTCGACGACGGGAGAATATCATT
CAGTTGGGTGGAATTAACGAACGACGAAAACGTGAAGAACATGTTTTGGG
AGCACATCATGTTCCAGTGGATCGATATGCGGGTAACGTTGTTGAGATCA
ACTGAAGATATATCAAGAGTCTGA
back to top
Properties
Property NameValue
NoteSubtilisin-like serine protease MAKER:12.3:0.22:Medtr1g069170
AED0.22
QI0|-1|0|1|-1|1|1|0|107
eAED0.25
CADL Non-redundant FlagN
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_14supercontigScc4a34_14:10960..11283 +