MSAD_210123.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210123.t1
Unique NameMSAD_210123.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length1260
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210123MSAD_210123Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210123.t1MSAD_210123.t1-proteinMedicago sativapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210123.t1:exon:258MSAD_210123.t1:exon:258Medicago sativaexon
MSAD_210123.t1:exon:259MSAD_210123.t1:exon:259Medicago sativaexon
MSAD_210123.t1:exon:260MSAD_210123.t1:exon:260Medicago sativaexon
MSAD_210123.t1:exon:261MSAD_210123.t1:exon:261Medicago sativaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210123.t1:cdsMSAD_210123.t1:cdsMedicago sativaCDS


Synonyms
The feature 'MSAD_210123.t1' has the following synonyms
Synonym
maker-Scc4a34_26-augustus-gene-5.24-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210123.t1 ID=MSAD_210123.t1|Name=MSAD_210123.t1|organism=Medicago sativa|type=mRNA|length=1260bp
GCACAAACTTTAAACCACTGATATGGTGAGACGGAGGGAGTATTTATGTT
TCTCTCTCATAAAAAACACTAGTGTCATGTGTGCCACCAAGAACTTTCCC
ACAGCTTCAATGTGAAAAAGAAGAAAAAAAAAAACACAATTTTGAAAAAT
TGGTTCGGTTCGGGTCAAATATCAAGTACTGGTTTTGAATTCAGTAAACT
TTTCTTTCTGAACCGAACATGGAAGCAGCGCGGCGGCTGGTGTGGCGTTT
ACGTTATTTTCCGATGCCGGTGCTCTCAAACGGTGTCGCATCACTCTCTT
CTTCATTTTCTAGTTGTAACACCAAAATTGAACTATTCAATACCAAATTT
TCCAAGTTCGGTTCAACATTATCATCACCTTCTTCTTCTTCTTCTTCTTC
TTCTTCTTCTTCAGAAACAGCATTACTAAGGAAAACTGTGAACAAATTGC
CTTACATTGTAAAAGCAGGTGATCCAGTTCTTCATGAGCCTGCACGTGAG
GTTGATCACAGTGAGATTAAATCAGACAAGATTCAGAATATTATTGATGA
TATGATTCTTGTCATGAGAAAAGCCCCTGGAGTTGGTGTTGCTGCCCCAC
AAATTGGTATCCCTTTAAGGATAATAGTTTTGGAGGATAAAGAAGAATAT
ATTAGTTACAACACAGAGGAGGAGACCAAAGCACAAGACAGAAGACCTTT
TGATCTTTTGGTGATTCTGAATCCCAAATTAAAGAACAAGAGCAACAGGA
ATGCCTTCTTTTTTGAAGGGTGCTTGAGTGTTGATCGATTTCAAGCTGTG
GTAGAGCGATACCTTGATGTTGAGGTTACAGGTTTTGATCGATATGGTGA
GCCAATCAAAATAAATGCTTCTGGTTGGCAGGCTCGAATTTTACAGCATG
AGTGTGATCACCTAGATGGAACACTATATGTCGATAAGATGGTACCTAGA
ACTTTCAGAAGTTGGAAAAACGTGGATCTGCCTCTTGCCCATGGGTGCCC
CAAACTTGGCCCCCGAGCGTAAAACTGGGACAGCCTCTGATTCAAAACTA
GTTTCATATGCACAACATTAGTGAAAAGTTTACATTTTTTGACCTTATGA
TGTAGTCCAGAATCTGATCCATTAAGTTAGAAGTATTGTGTCAGTTTTGT
AATTAGTAAATTTCCTCAAATTTTTAGTATTATCCTGTTGAAATCTGTTA
CTGCAGTCTGTTAGTACTTTCTGATCAATTCATTAAATATAAGATTCAAT
AATAGGGATA
back to top

protein sequence of MSAD_210123.t1

>MSAD_210123.t1-protein ID=MSAD_210123.t1-protein|Name=MSAD_210123.t1|organism=Medicago sativa|type=polypeptide|length=268bp
MEAARRLVWRLRYFPMPVLSNGVASLSSSFSSCNTKIELFNTKFSKFGST
LSSPSSSSSSSSSSSETALLRKTVNKLPYIVKAGDPVLHEPAREVDHSEI
KSDKIQNIIDDMILVMRKAPGVGVAAPQIGIPLRIIVLEDKEEYISYNTE
EETKAQDRRPFDLLVILNPKLKNKSNRNAFFFEGCLSVDRFQAVVERYLD
VEVTGFDRYGEPIKINASGWQARILQHECDHLDGTLYVDKMVPRTFRSWK
NVDLPLAHGCPKLGPRA.
back to top

mRNA from alignment at Scc4a34_26:483531..488511+

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210123.t1 ID=MSAD_210123.t1|Name=MSAD_210123.t1|organism=Medicago sativa|type=mRNA|length=4981bp|location=Sequence derived from alignment at Scc4a34_26:483531..488511+ (Medicago sativa)
GCACAAACTTTAAACCACTGATATGGTGAGACGGAGGGAGTATTTATGTT TCTCTCTCATAAAAAACACTAGTGTCATGTGTGCCACCAAGAACTTTCCC ACAGCTTCAATGTGAAAAAGAAGAAAAAAAAAAACACAATTTTGAAAAAT TGGTTCGGTTCGGGTCAAATATCAAGTACTGGTTTTGAATTCAGTAAACT TTTCTTTCTGAACCGAACATGGAAGCAGCGCGGCGGCTGGTGTGGCGTTT ACGTTATTTTCCGATGCCGGTGCTCTCAAACGGTGTCGCATCACTCTCTT CTTCATTTTCTAGTTGTAACACCAAAATTGAACTATTCAATACCAAATTT TCCAAGTTCGGTTCAACATTATCATCACCTTCTTCTTCTTCTTCTTCTTC TTCTTCTTCTTCAGAAACAGCATTACTAAGGAAAACTGTGAACAAATTGC CTTACATTGTAAAAGCAGGTGATCCAGTTCTTCATGAGCCTGCACGTGAG GTTGATCACAGTGAGATTAAATCAGACAAGATTCAGAATATTATTGATGA TATGATTCTTGTCATGAGAAAAGCCCCTGGAGTTGGTGTTGCTGCCCCAC AAATTGGTATCCCTTTAAGGGTATGAATCAAAAATGAGCTTTTGTTGTTA TTGTTGTCACTGACACATGTGATGAGTTATGCCATTTTCTCAAATTATTA TAAGCTGTATAGTGTCTTTGTCAATACAAAAATGGAGTAATTGAATGTAA CTACATGTGTTTTGGTAGTATCATGTTGGACAGGAAATGGATTCTCTCCT TTGAAACAAAACTATAATGTGGAGACCTTGACCATCTCCACATTATTTTC TCAATTTTTCTTTTTTTCCAATGGAGAGAATATTGACCCTATTGGACATT CTTTGGTACATTGAGGTCGGTGCCTCAATGAGAAGATAGTGGGGGTCTGA GATGACTATTAAAGAGTCTCACATTGGATGAGAGATTGCATGATCAAGTG TTTATAAGTGGGGGTAGTCCTCACCTCACATATAGATTTTGTAAGGTTGA GTTAGGCCTAACCACAAATTCTAAGATGGTATTAGAGCCCCCTCCAAGAT TGTTTAAACTGTTTGCTTCCAGGTTACGCTATCGAGCCACCCACCATTTA TACCAACGCACCAAGCCTAATAGTCTTGGGCTTGAAGGAGTGTGTTAAAA GAGTCTCGTATTGGATGAGAGATGGCATGTGTTTATAAGTGGGGCAGTTC TCACTTTACAAACATGTTTTGTGGGGTTGTGTTAGACCCAACCACAAATT CTAAGAACGATTGACTAGAGGAATCCACAACCTAGCCAAGACGGCTGATC AGGACACTTGTCCATAGGAGAGCGCTAGCATGGCCGACCAGGGTACCAGA GTGTCATTAGTTGGTAGAGTAATTTATCTGTACCGCAAGTGCCACCTACC GCTACGGCACTACTCTGTTCATCGTCCTCATTGCTAACTAAAAATAGAAT ATCTAATGGGAGCCACACCCTATTTAGTATTGGGTCTGACAATGATTGGA GAAGCCCAGGAATTTTAGGAAAGCCTAGCAGGGGGAGCACTATAAAATTG GACTTAACATTTAGGGCAAAGGCATGTTCTACACACATTTCCATAAATCA TAGGTGACCACTCGCTCATTAGGCGCTGTGTTCTAGACTAGAACAGATGC AAACACCATGTCGAACATCACACACCTTTAATGTGAAGTGTCGCTGTGTC GGTTTTACATAGGCTGATGTTGTTGGACTTAAGCATGTTTTTCCGGTGTT TTCTTTTATGTATGCAGATAATAGTTTTGGAGGATAAAGAAGAATATATT AGTTACAACACAGAGGAGGAGACCAAAGCACAAGACAGAAGACCTTTTGA TCTTTTGGTATGTATGTTTCCATATATGATGTGTGAATCAGAGAACGAAT GATAGCTTCTTTTTTTATGTTACATGTGAATGAATATTAAGAAACTGCCT TTGTGGGTCACCAAGTAACCTGGGATATGTAATGCAAGCTAAAAATCATA TGACAAATAATATAAAAGATTCTGGAAGCATGGATTGGACTATTTTAACT TGTATCAGTGGTATATTGGCTGAAAGAAGAAGCTTTCCACAGCTTGGAGT CATTTGGAAGATATAAGAATTAACTAACCAGCGTGCAATAAGATAAACCA TCTGTCAACATTTGAATAATATATACACATTTTCTATGATCAGTATGCAT GTTACTATTAATTCTAATAATTACTTGATTACATTACATTATACTACAAT TAATTGCTATTGTCTAATTGTTACAATTTGTGACTTTCCAACAGTGAAAG AGACGCCCTATATATGATTAGAAATATTTTCCTCGCACAAATTAGTAAAA TTAACTACTAGTAGTTCATTGTTTCTTCTGATCTGGCATTGGAAAATGAG CATATACATTAAATAGAAACACGGATTTGAAATTTGAAGTTAGCTATGAA TTGCATTGCAGTCATTAAGATGCAAGTTATTGTAAACCAGAGGGGTGATC GAAACCTGGATGCAGCTACTCGGTCCAATTTCAAGGGCCTTTCACTCTCT AAGAAGTAGCTAATTACGTTTAACGACTAGTGCATGTTCAAAAGCTATCA TTTGTTCATTATAAAAAAAGTAACCGTTCATTCATTTATTGAAATTAAAT TCAGTTTTGTTTTGTACATGAGATATATTACTTGAGTAATAACATTCATT CAGTAGATCTCTTGACTGATGCAGGTGATTCTGAATCCCAAATTAAAGAA CAAGAGCAACAGGAATGCCTTCTTTTTTGAAGGGTGCTTGAGGTGTGGCA ATAATTTACTAACAACTTTTTCATTTTCTGTTGCCATACTTGCAATTTCA AAACTGACATGCCATTTGTTCATGGTCATATTTAGGAATGTGCAAATCTT GGTTTAATATTTAGGCTAAAATATGGTTTTAGTCCCTGCAAATATGCCTT GTTTTGATTTTAATCCCTGTAAAAAAAATTTGTTGTTTTTGGTCCCTGCA AAATATTTTGTTTTTGAAAATAGTCCCTGACCCTACTTTTGTGATGATAT GCATACGTGACACATGATGGCTGAACCTATTTCGTAGTTTTTGGTCCCTG CAAAATATTTTGTTTTTTAAAAAGGTTCCTGCAAAATATTTTGATTTTGA AAATAGTCCCTCCAGGGACTATTTTAAAAAACAAAAAATTTTGCAGGGAC CAAAAACTATTTTTTTTTTTTTACAGTGACTAAAACCAAAACGAGACATA TTTGCAGGGACTAAAACCATATTTTAGCCTAATATTTAAAATGGCAGTCT AAATTCTTGATGGTACACTGTTTGTCCTTTCTTTAGCGATGGCTTAAAAT TTCATGAGACCAAGTTCTTTTATGACTTACTTTAGCAACAACATCAAACA AGCCTGATCCCACTAAGTGGGGTTGGCTTCTGACTTTTTTTTGAATCAGG GGTTGGCTTCTGACTGACTTTAGCATTATAAGGAAAATTTGATAGGATCA ATTTTGAAGCAATCACAACCAAATCATAAAATGATTTCTCTTAACATGTA TCTTTATGTATGTGTGTGTGATTCCAAATGAACGAATTCTTCAGTGTTGA TGTTGTTTAAGCTATTATTTTGCCTAAAAGCTAAAAAGTAGCAAAGTCTT TATTCTCTTTCACTTACAAGGACTGCTCAACTGGTGATACATCTAAGTTG GCATCCATGTAACCCAATACATAGCAGAATTGCTTATGTTTATTTCAAAA CATGGTTGTTTGGTTTCACGTGGATTTTTTTCACAATGTAAGGGTTGCCT GAGGCTGAGTATACTCGGGTGGACTATGCTTAAGTTCAATTTAATCAACC TATGTCTATCTTAGTTTTAACATCTGGTATGAACTTCTCTTAGCTTTTCT TGTCTTTTTTTTAAACAAAAATGAGATCCAATATCCATTATCTTTTGTGG AGGTTGAGCTTTGCTGTACCAAATTTTCCTTTGTCAGTATTGAAGTTGCC GTTAGTATTGTTGCGAGTTCCACATTCAATGTGATATGACCCAAAAAGTG TTTATAAGTGGGAGGCATCCATCACCTTATAAACCGGTTTTGTAATGGGT TGAGTTAGGTCCAATCCAAATTCTAAGTAGAATGTACAAACATGGGTGTA GTTCACCAAAGAGGAAAGCAGCGTTTGTAACAAAACAATTGAATCTCTTA TTATGATTATTGTGTCCTCTGATTGTAAATATGCCGTGTTTGTAAGAGAT TTTCCTCTAACCTGATTAGAGTTGATTGAATTTGTTGGATCTGTTATCAG TTATGTAATATCGTTTTTAAAGTTGTCAAAATTTCAAAAATATGGTAATT CTGGCTTGCTCCATATTTTTGTGGTTTATGTGGCAATAATGTGTGCAGAA CTACATATATCCAAGTTACATTAACATCACTTGCAATAACATTTTGCAGT GTTGATCGATTTCAAGCTGTGGTAGAGCGATACCTTGATGTTGAGGTTAC AGGTTTTGATCGATATGGTGAGCCAATCAAAATAAATGCTTCTGGTTGGC AGGCTCGAATTTTACAGCATGAGTGTGATCACCTAGATGGAACACTATAT GTCGATAAGATGGTACCTAGAACTTTCAGAAGTTGGAAAAACGTGGATCT GCCTCTTGCCCATGGGTGCCCCAAACTTGGCCCCCGAGCGTAAAACTGGG ACAGCCTCTGATTCAAAACTAGTTTCATATGCACAACATTAGTGAAAAGT TTACATTTTTTGACCTTATGATGTAGTCCAGAATCTGATCCATTAAGTTA GAAGTATTGTGTCAGTTTTGTAATTAGTAAATTTCCTCAAATTTTTAGTA TTATCCTGTTGAAATCTGTTACTGCAGTCTGTTAGTACTTTCTGATCAAT TCATTAAATATAAGATTCAATAATAGGGATA
back to top

Coding sequence (CDS) from alignment at Scc4a34_26:483531..488511+

>MSAD_210123.t1 ID=MSAD_210123.t1|Name=MSAD_210123.t1|organism=Medicago sativa|type=CDS|length=804bp|location=Sequence derived from alignment at Scc4a34_26:483531..488511+ (Medicago sativa)
ATGGAAGCAGCGCGGCGGCTGGTGTGGCGTTTACGTTATTTTCCGATGCC
GGTGCTCTCAAACGGTGTCGCATCACTCTCTTCTTCATTTTCTAGTTGTA
ACACCAAAATTGAACTATTCAATACCAAATTTTCCAAGTTCGGTTCAACA
TTATCATCACCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCAGAAAC
AGCATTACTAAGGAAAACTGTGAACAAATTGCCTTACATTGTAAAAGCAG
GTGATCCAGTTCTTCATGAGCCTGCACGTGAGGTTGATCACAGTGAGATT
AAATCAGACAAGATTCAGAATATTATTGATGATATGATTCTTGTCATGAG
AAAAGCCCCTGGAGTTGGTGTTGCTGCCCCACAAATTGGTATCCCTTTAA
GGATAATAGTTTTGGAGGATAAAGAAGAATATATTAGTTACAACACAGAG
GAGGAGACCAAAGCACAAGACAGAAGACCTTTTGATCTTTTGGTGATTCT
GAATCCCAAATTAAAGAACAAGAGCAACAGGAATGCCTTCTTTTTTGAAG
GGTGCTTGAGTGTTGATCGATTTCAAGCTGTGGTAGAGCGATACCTTGAT
GTTGAGGTTACAGGTTTTGATCGATATGGTGAGCCAATCAAAATAAATGC
TTCTGGTTGGCAGGCTCGAATTTTACAGCATGAGTGTGATCACCTAGATG
GAACACTATATGTCGATAAGATGGTACCTAGAACTTTCAGAAGTTGGAAA
AACGTGGATCTGCCTCTTGCCCATGGGTGCCCCAAACTTGGCCCCCGAGC
GTAA
back to top
Properties
Property NameValue
NotePeptide deformylase MAKER:9.1:0.21:Medtr2g103430
AED0.21
QI218|1|1|1|0.66|0.75|4|238|267
eAED0.21
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Gene Ontology Update2017-11-12
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_26supercontigScc4a34_26:483531..488511 +
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006412 translation
cellular_component GO:0009507 chloroplast
molecular_function GO:0046872 metal ion binding
molecular_function GO:0042586 peptide deformylase activity