MSAD_210124.t1 (mRNA; Medicago sativa )

Overview
NameMSAD_210124.t1
Unique NameMSAD_210124.t1
TypemRNA
OrganismMedicago sativa (alfalfa)
Sequence length2035
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
MSAD_210124MSAD_210124Medicago sativagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210124.t1MSAD_210124.t1-proteinMedicago sativapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210124.t1:cdsMSAD_210124.t1:cdsMedicago sativaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
MSAD_210124.t1:exon:272MSAD_210124.t1:exon:272Medicago sativaexon
MSAD_210124.t1:exon:273MSAD_210124.t1:exon:273Medicago sativaexon
MSAD_210124.t1:exon:274MSAD_210124.t1:exon:274Medicago sativaexon
MSAD_210124.t1:exon:275MSAD_210124.t1:exon:275Medicago sativaexon
MSAD_210124.t1:exon:276MSAD_210124.t1:exon:276Medicago sativaexon
MSAD_210124.t1:exon:277MSAD_210124.t1:exon:277Medicago sativaexon
MSAD_210124.t1:exon:278MSAD_210124.t1:exon:278Medicago sativaexon


Synonyms
The feature 'MSAD_210124.t1' has the following synonyms
Synonym
maker-Scc4a34_26-augustus-gene-5.29-mRNA-1
Sequences
The following sequences are available for this feature:

mRNA sequence

>MSAD_210124.t1 ID=MSAD_210124.t1|Name=MSAD_210124.t1|organism=Medicago sativa|type=mRNA|length=2035bp
CTTCTTGTAAGATTTTGACAGACAACGCCTCAGTTCAGCAGGTACTTTTT
TGGTTGGTTAGAATGAGATCTTCTTCTTCCATTTCTATATATATCATTGT
TATTATCTCCATTGTACTTGTTCCTTTATTCATCCACCATGCACAAGCAC
AAGCACAACCACAAGGACTTGACTCTATTATCAAACTCCCACGTTCTGGG
TCAACCCGAACCAGATCCAAATCCAAATCCAGGCGGGTTCTTTCCATCAC
TCATTTTGGTGCCATAGGTGATGGTTTTCATAATGACACTCAGGCCTTCT
TGAAGGTTTGGGAAATTGCTTGTTCTCTCTCTGGATTCATCAATATAGTT
TTTCCATATGAAAAAACTTTTCTTGTCAGTCCAATTGACATTGGTGGACC
GTGTCGATCTAAGATCACTTTGAGGATCTTAGGAACAATAGTTGCACCAC
GAGACCCTGACGTATGGCATGGTTTAAATAAGCGCAAATGGATTTACTTC
CACGGGGTGAATCACCTTTCTGTAGAAGGTGGAGGGAGAATAGATGGAAT
GGGACAGGAATGGTGGTCCAGATCTTGCAAGATCAACTCCACTAATCCAT
GTCTTCCTGCTCCAACGGCCTTGACTTTTCATAAATGCAAGAGTCTGAAA
GTCAGAAACCTTATGGTGCTAAATAGCCAAAAAATGCACATCGCGTTCAC
TAGCTGTATGCGGGTTGTTGCATCACGTCTCAAAGTATTAGCACCTGCCT
CCAGCCCTAATACCGATGGAATCCACATTAGTGCTACAAAAGGTGTTGAG
ATTAAAGATAGTGTAATTAGAACAGGTGATGACTGCATCTCCATAGTCAG
AAATTCTTCACGGGTCTGGATCCGAAATATTTCCTGTGGTCCAGGTCATG
GCATAAGCATTGGTAGCTTAGGAAAATCAAACGTATGGGAGAAGATTCAA
AATGTAATTGTTGATGGAGCACATCTATACAACACTGATAATGGGGTGAG
AATCAAAACATGGCAGGTAACTTTCTTCGTAACTGTATCATTTTCATTCT
CATTATATATTTCACCTAGTGATGACAAGTCTATTGAGTCGAGCCAAATT
TTCAAGGGTGGGAGTGGTTTTGCCTCCAAGATCACATTCCAGAATATCTT
AATGGAAAATGTGTCCAATCCAATAATAATAGATCAATACTACTGCGATT
CACGACATCCATGCAAGAATCAGGTATTGAATTTTAAGATATTTTTGCTG
GATTTTTTTGTATGTCTGCATGTTCATGTACTGACACTATTAATAGTCAG
ACAGTGATTTTTTTGAGAGGATAGCCTATATAGTTTTGAATGATTTGTAG
AATGTAATAGCTGATTTCACAATTTCCATCGATTATAATCATGTCAGTGA
CACACATTCCTGTCAATCTCCAACAAGGATTCAAATTAATGAAGTTTCAT
AATAATATAATTCAACTGAAGATATTATGCTGTAAAAATTTATGCAGACT
TCAGCTGTTCAAGTGGGAAACATATCCTTCATTAATATTCTAGGAACTTC
AGCCACCGAAGAAACCATTAAATTTGCCTGCAGTGATGCTTCTCCATGTG
AAGGACTATATCTGGAAAATATTTTTCTTCAATCATACTTTGGAGGAAAT
ACAAGATCTTATTGTTGGCAAGCTCATGGCTCTGCTCAAGGTTATGTGTA
CCCTCCTGCCTGCTTTTCGACAAGTAGTGATTTAATTAGACAAAATGTCT
TGTTAGAGCCAAATCCTGCTATTAATTCTGTCTGAACAGAAGGTATTTTG
TACATAATAAAACAAGTAGATGAACCCCTTGATATATATTTTACAGGGTA
TTCAAGGTCTTGTTAGAGTCATATGGTGATAAGTCTGTATTCATAATCCA
TATGAATGCATGCACTTGCATTATTGAATTTGAACTATTTTCTTGGTAGT
GTTATCTTTTTTTCGATGTAGTTCCAGTTATCTGTTCTGTGTCATGTAAT
CTCTAACGTCGATTGAATGAATGCCTCAAAAAAAT
back to top

protein sequence of MSAD_210124.t1

>MSAD_210124.t1-protein ID=MSAD_210124.t1-protein|Name=MSAD_210124.t1|organism=Medicago sativa|type=polypeptide|length=415bp
MRSSSSISIYIIVIISIVLVPLFIHHAQAQAQPQGLDSIIKLPRSGSTRT
RSKSKSRRVLSITHFGAIGDGFHNDTQAFLKVWEIACSLSGFINIVFPYE
KTFLVSPIDIGGPCRSKITLRILGTIVAPRDPDVWHGLNKRKWIYFHGVN
HLSVEGGGRIDGMGQEWWSRSCKINSTNPCLPAPTALTFHKCKSLKVRNL
MVLNSQKMHIAFTSCMRVVASRLKVLAPASSPNTDGIHISATKGVEIKDS
VIRTGDDCISIVRNSSRVWIRNISCGPGHGISIGSLGKSNVWEKIQNVIV
DGAHLYNTDNGVRIKTWQVTFFVTVSFSFSLYISPSDDKSIESSQIFKGG
SGFASKITFQNILMENVSNPIIIDQYYCDSRHPCKNQVLNFKIFLLDFFV
CLHVHVLTLLIVRQ.
back to top

mRNA from alignment at Scc4a34_26:489527..493100-

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>MSAD_210124.t1 ID=MSAD_210124.t1|Name=MSAD_210124.t1|organism=Medicago sativa|type=mRNA|length=3574bp|location=Sequence derived from alignment at Scc4a34_26:489527..493100- (Medicago sativa)
CTTCTTGTAAGATTTTGACAGACAACGCCTCAGTTCAGCAGGTACTTTTT TGGTTGGTTAGAATGAGATCTTCTTCTTCCATTTCTATATATATCATTGT TATTATCTCCATTGTACTTGTTCCTTTATTCATCCACCATGCACAAGCAC AAGCACAACCACAAGGACTTGACTCTATTATCAAACTCCCACGTTCTGGG TCAACCCGAACCAGATCCAAATCCAAATCCAGGCGGGTTCTTTCCATCAC TCATTTTGGTGCCATAGGTGATGGTTTTCATAATGACACTCAGGTATTAA TTATGATACTGTTTTCCCTTGAATTTGGACTTTTGATGTTGTTGTTGGTA CATTTTTGTTAATGATTTTTATCATGTACAAAATGTATTTGTTGTTCATT CACAAATGCATCATAGTGAAATGTAAATGATATTCATTCATAGTCCACAA GGATGTTTTTGCAAGTTGGGTGTTTCTTTTTAAAATGTGAGCATAATAGA GAATTTTGATTTATAGCCAGCCACTGAATGTTAGGTGATTTGTCTCATTG AGCTAGATATAGGATAAGTAAATTTTAGAATCTTCATCAATGATACTTTG TTACCATGATATACTGATAAACAGGTTATTAATTTTTTTATCTATCTTTT CAGGCCTTCTTGAAGGTTTGGGAAATTGCTTGTTCTCTCTCTGGATTCAT CAATATAGTTTTTCCATATGAAAAAACTTTTCTTGTCAGTCCAATTGACA TTGGTGGACCGTGTCGATCTAAGATCACTTTGAGGGTAAGCACCAAGAGT GTGTGAAATCTACCGGATTTTAAACGAATTTCTGTCATATGTATCATTCA ATTCTTGAATGAAATGTGTCGTATTGAAAATGTTTATTATTATTTGTTTT ATAGATCTTAGGAACAATAGTTGCACCACGAGACCCTGACGTATGGCATG GTTTAAATAAGCGCAAATGGATTTACTTCCACGGGGTGAATCACCTTTCT GTAGAAGGTGGAGGGAGAATAGATGGAATGGGACAGGAATGGTGGTCCAG ATCTTGCAAGATCAACTCCACTAATGTATTGCTATCTCAGAAACTTATTT TCATATGTAGTTGAAGTTTATTCATCAGTTTAACCAAGTGATGATGACTT CAAAATCTCCTTTTGCAGCCATGTCTTCCTGCTCCAACGGTTAGTGGCGC TTCAAAATATGGAGCAAAACAGTTCATTTCTCTAATCTGATGATACATTA ATTATGAATCTATTAGCTGAAATATGAAACTTCATTTACTATGTAGGCCT TGACTTTTCATAAATGCAAGAGTCTGAAAGTCAGAAACCTTATGGTGCTA AATAGCCAAAAAATGCACATCGCGTTCACTAGCTGTATGCGGGTTGTTGC ATCACGTCTCAAAGTATTAGCACCTGCCTCCAGCCCTAATACCGATGGAA TCCACATTAGTGCTACAAAAGGTGTTGAGATTAAAGATAGTGTAATTAGA ACAGGTGTGTTATCCTCAATCTAATGCAATGCTAGTGTTACTCATATTGG AAGATTTCAGTGATAGTTTAACATCTTATTTATTTTAAATAGTAATAACA TGTTGGTGTTTTAACAGTCAATCATATTTCAGAAATCATAGAAACTTGTT TTTAGTAAAATATAGGATAAGCAGAAAGAAACTATCGTAACAATGAATAA ACTTTGTAGGCATAAGGGCAGCCTAATGCACTAAAGCTCCCGCATATGCA ATGTCTGGGAAGGGGTCCCACCATTTGGTGTATTGTATGCAGCCTTACCT TGTTTTTTACACAAGGGATTGTTTTGAAGACTTGAACGCGTGACCTTTCA GTCACGTGATAACAATTTTACTGTTGCGAAGACTCCCCCTACTTTGTAGG CATCTTATAAGTTTTTAAGTTTTATGATTATCATTATTATTTTTGAATGT ATGGAACTAGTTGAATATGATATGCATGTCATTCCCTATATGATATTTTC AGTTGTGTAGCTTTTAAACTTTGGAAATGTTTAATGTTGTAAGGGAGATA GGGGGAAAGGCATGTGCAACCAACCTGAACAATAAACCAACAATAATGTA ACATTGAAACACCATAAAAATGTGTAAATCATTTATAAGGTCAGAGAAAT GTGTAACCTTGAAACACCATAGAAATGACTACTTTCATTACCGTTTTGTA GAAGTTCCAGAATAAACTTAATGATCAAGTAATGTGTCAGAAGACAAACA TTTCACTGCATTATGTCCCATTTCAGGTGATGACTGCATCTCCATAGTCA GAAATTCTTCACGGGTCTGGATCCGAAATATTTCCTGTGGTCCAGGTCAT GGCATAAGGTGAAAGTAATGTTCACTTTTAGTTCATTAGGATACCAAGTA GTATAAATTGTATAATTCTTAACCGATACTTGAACCTATTTTTCAGCATT GGTAGCTTAGGAAAATCAAACGTATGGGAGAAGATTCAAAATGTAATTGT TGATGGAGCACATCTATACAACACTGATAATGGGGTGAGAATCAAAACAT GGCAGGTAACTTTCTTCGTAACTGTATCATTTTCATTCTCATTATATATT TCACCTAGTGATGACAAGTCTATTGAGTCGAGCCAAATTTTCAAGGGTGG GAGTGGTTTTGCCTCCAAGATCACATTCCAGAATATCTTAATGGAAAATG TGTCCAATCCAATAATAATAGATCAATACTACTGCGATTCACGACATCCA TGCAAGAATCAGGTATTGAATTTTAAGATATTTTTGCTGGATTTTTTTGT ATGTCTGCATGTTCATGTACTGACACTATTAATAGTCAGACAGTGATTTT TTTGAGAGGATAGCCTATATAGTTTTGAATGATTTGTAGAATGTAATAGC TGATTTCACAATTTCCATCGATTATAATCATGTCAGTGACACACATTCCT GTCAATCTCCAACAAGGATTCAAATTAATGAAGTTTCATAATAATATAAT TCAACTGAAGATATTATGCTGTAAAAATTTATGCAGACTTCAGCTGTTCA AGTGGGAAACATATCCTTCATTAATATTCTAGGAACTTCAGCCACCGAAG AAACCATTAAATTTGCCTGCAGTGATGCTTCTCCATGTGAAGGACTATAT CTGGAAAATATTTTTCTTCAATCATACTTTGGAGGAAATACAAGATCTTA TTGTTGGCAAGCTCATGGCTCTGCTCAAGGTTATGTGTACCCTCCTGCCT GCTTTTCGACAAGTAGTGATTTAATTAGACAAAATGTCTTGTTAGAGCCA AATCCTGCTATTAATTCTGTCTGAACAGAAGGTATTTTGTACATAATAAA ACAAGTAGATGAACCCCTTGATATATATTTTACAGGGTATTCAAGGTCTT GTTAGAGTCATATGGTGATAAGTCTGTATTCATAATCCATATGAATGCAT GCACTTGCATTATTGAATTTGAACTATTTTCTTGGTAGTGTTATCTTTTT TTCGATGTAGTTCCAGTTATCTGTTCTGTGTCATGTAATCTCTAACGTCG ATTGAATGAATGCCTCAAAAAAAT
back to top

Coding sequence (CDS) from alignment at Scc4a34_26:489527..493100-

>MSAD_210124.t1 ID=MSAD_210124.t1|Name=MSAD_210124.t1|organism=Medicago sativa|type=CDS|length=1245bp|location=Sequence derived from alignment at Scc4a34_26:489527..493100- (Medicago sativa)
ATGAGATCTTCTTCTTCCATTTCTATATATATCATTGTTATTATCTCCAT
TGTACTTGTTCCTTTATTCATCCACCATGCACAAGCACAAGCACAACCAC
AAGGACTTGACTCTATTATCAAACTCCCACGTTCTGGGTCAACCCGAACC
AGATCCAAATCCAAATCCAGGCGGGTTCTTTCCATCACTCATTTTGGTGC
CATAGGTGATGGTTTTCATAATGACACTCAGGCCTTCTTGAAGGTTTGGG
AAATTGCTTGTTCTCTCTCTGGATTCATCAATATAGTTTTTCCATATGAA
AAAACTTTTCTTGTCAGTCCAATTGACATTGGTGGACCGTGTCGATCTAA
GATCACTTTGAGGATCTTAGGAACAATAGTTGCACCACGAGACCCTGACG
TATGGCATGGTTTAAATAAGCGCAAATGGATTTACTTCCACGGGGTGAAT
CACCTTTCTGTAGAAGGTGGAGGGAGAATAGATGGAATGGGACAGGAATG
GTGGTCCAGATCTTGCAAGATCAACTCCACTAATCCATGTCTTCCTGCTC
CAACGGCCTTGACTTTTCATAAATGCAAGAGTCTGAAAGTCAGAAACCTT
ATGGTGCTAAATAGCCAAAAAATGCACATCGCGTTCACTAGCTGTATGCG
GGTTGTTGCATCACGTCTCAAAGTATTAGCACCTGCCTCCAGCCCTAATA
CCGATGGAATCCACATTAGTGCTACAAAAGGTGTTGAGATTAAAGATAGT
GTAATTAGAACAGGTGATGACTGCATCTCCATAGTCAGAAATTCTTCACG
GGTCTGGATCCGAAATATTTCCTGTGGTCCAGGTCATGGCATAAGCATTG
GTAGCTTAGGAAAATCAAACGTATGGGAGAAGATTCAAAATGTAATTGTT
GATGGAGCACATCTATACAACACTGATAATGGGGTGAGAATCAAAACATG
GCAGGTAACTTTCTTCGTAACTGTATCATTTTCATTCTCATTATATATTT
CACCTAGTGATGACAAGTCTATTGAGTCGAGCCAAATTTTCAAGGGTGGG
AGTGGTTTTGCCTCCAAGATCACATTCCAGAATATCTTAATGGAAAATGT
GTCCAATCCAATAATAATAGATCAATACTACTGCGATTCACGACATCCAT
GCAAGAATCAGGTATTGAATTTTAAGATATTTTTGCTGGATTTTTTTGTA
TGTCTGCATGTTCATGTACTGACACTATTAATAGTCAGACAGTGA
back to top
Properties
Property NameValue
NoteGlycoside hydrolase family 28 MAKER:9.1:0.08:Medtr2g103410
AED0.08
QI62|1|1|1|1|1|7|728|414
eAED0.08
CADL Non-redundant FlagY
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Gene Ontology Update2017-11-12
Whole Genome Assembly and Annotation of Medicago sativa2016-01-05
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Scc4a34_26supercontigScc4a34_26:489527..493100 -
Gene Ontology
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0005975 carbohydrate metabolic process
biological_process GO:0071555 cell wall organization
cellular_component GO:0005576 extracellular region
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004650 polygalacturonase activity